| IED ID | IndEnz0002011166 |
| Enzyme Type ID | protease011166 |
| Protein Name |
Turripeptide Lol9.1 Turripeptide OL11 |
| Gene Name | |
| Organism | Lophiotoma olangoensis (Sea snail) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Turridae Iotyrris Lophiotoma olangoensis (Sea snail) |
| Enzyme Sequence | MKVYCLLLVLLVGLVSQAHGKPTKRCLSVCSAEYEPVCGSDGKTYANKCHLMTEACWSPTSITLVHEGKC |
| Enzyme Length | 70 |
| Uniprot Accession Number | P0DKM7 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Acts as a neurotoxin by inhibiting an ion channel (By similarity). May also act as a serine protease inhibitor, since it possess the kazal serine protease inhibitor signature. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Domain (1); Signal peptide (1); Site (1) |
| Keywords | Disulfide bond;Ion channel impairing toxin;Neurotoxin;Protease inhibitor;Secreted;Serine protease inhibitor;Signal;Toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..20; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 7,603 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |