| IED ID | IndEnz0002011176 |
| Enzyme Type ID | protease011176 |
| Protein Name |
Cysteine-rich venom protein CRVP EC 3.4.-.- Substrate-specific endoprotease Tex31 |
| Gene Name | |
| Organism | Conus textile (Cloth-of-gold cone) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae (cone shells) Conus Cylinder Conus textile (Cloth-of-gold cone) |
| Enzyme Sequence | MLSTMQTVGAVLMLSIVLVAGRKRHHCDSKYYELTPAHTMCLTDKPNAVAVPLTQETEHEILEMHNKIRADVTDAANMLKMEWDERLATVAQKWAMQCILGHDSGRRGEPDLPGSVGQNVAWSSGDLTFLGAVQMWADEIVDFQYGVWTDGTGHYIQQVFAGASRIGCGQSACGNNKYFVCNYYKGTMGDEPYQLGRPCSQCRSSCQHIRGSQGRWGSLCDCTNGPDACFNGGIFNINTCQCECSGIWGGADCQEKHCPNEDFDDMCRYPDALRRPQHWCQYDNFQSDCPILCGYCPNPN |
| Enzyme Length | 300 |
| Uniprot Accession Number | Q7YT83 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.-.- |
| Enzyme Function | FUNCTION: Protease responsible for cleaving the conotoxins from their propeptide precursors. The target propeptide requires minimum four residues including a leucine N-terminal of the cleavage site for efficient substrate processing (example: Xaa-Xaa-Xaa-Leu-Asn-Lys-Arg-toxin). |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1); Propeptide (1); Signal peptide (1) |
| Keywords | Cleavage on pair of basic residues;Direct protein sequencing;Disulfide bond;Hydrolase;Protease;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | PTM: Contains 11 disulfide bonds. |
| Signal Peptide | SIGNAL 1..21 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 33,373 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |