IED ID | IndEnz0002011188 |
Enzyme Type ID | protease011188 |
Protein Name |
Beta-fibrinogenase mucrofibrase-1 EC 3.4.21.- Snake venom serine protease SVSP Tm-VIG |
Gene Name | |
Organism | Protobothrops mucrosquamatus (Taiwan habu) (Trimeresurus mucrosquamatus) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Viperidae Crotalinae (pit vipers) Protobothrops Protobothrops mucrosquamatus (Taiwan habu) (Trimeresurus mucrosquamatus) |
Enzyme Sequence | MVLIRVLANLLILQLSYAQKSSELVIGGDECNINEHPFLVLVYYDDYQCGGTLLNEEWVLTAAHCNGKDMEIYLGVHSKKVPNKDVQRRVPKEKFFCDSSKTYTKWNKDIMLIRLDRPVRKSAHIAPLSLPSSPPSVGSVCRVMGWGTITSPQETYPDVPHCANINLLDYEVCRAAYAGLPATSRTLCAGILEGGKDSCVGDSGGPLICNGQFQGIVSWGGDPCAQPREPGVCTNVFDHLDWIKGIIAGNTDVTCPL |
Enzyme Length | 257 |
Uniprot Accession Number | Q91507 |
Absorption | |
Active Site | ACT_SITE 64; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 109; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 203; /note=Charge relay system; /evidence=ECO:0000250 |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | 3.4.21.- |
Enzyme Function | FUNCTION: Snake venom serine protease with strong beta-fibrinogenolytic activities, angiotensin I (AGT)-degrading activities and strong kallikrein-like activities in vitro, releasing bradykinin from kininogen (KNG1). Intravenous injection strongly lowers blood pressure in experimental rats, which may be explained by the action on angiotensin I and kininogen. {ECO:0000269|PubMed:11237764, ECO:0000269|PubMed:7811255}. |
Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Heat-stable to about 95 degrees Celsius. {ECO:0000269|PubMed:11237764}; |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Active site (3); Chain (1); Disulfide bond (6); Domain (1); Propeptide (1); Signal peptide (1) |
Keywords | Disulfide bond;Fibrinogenolytic toxin;Hemostasis impairing toxin;Hydrolase;Hypotensive agent;Protease;Secreted;Serine protease;Signal;Toxin;Zymogen |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | SIGNAL 1..18; /evidence=ECO:0000250 |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 28,099 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |