| IED ID | IndEnz0002011200 |
| Enzyme Type ID | protease011200 |
| Protein Name |
Kunitz-type serine protease inhibitor 1 Venom basic protease inhibitor 1 Venom trypsin inhibitor I cVamTi |
| Gene Name | |
| Organism | Vipera ammodytes ammodytes (Western sand viper) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Viperidae Viperinae (vipers) Vipera Vipera ammodytes (Nose-horned viper) Vipera ammodytes ammodytes (Western sand viper) |
| Enzyme Sequence | MSSGGLLLLLGLLTLWAELTPVSGQDHPKFCYLPADPGRCKAHIPRFYYDSASNKCNKFIYGGCPGNANNFKTWDECRQTCGASAMGRPT |
| Enzyme Length | 90 |
| Uniprot Accession Number | P00991 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Serine protease inhibitor that principally inhibits trypsin (Ki=0.34 nM). Also inhibits alpha-chymotrypsin (Ki=270 nM), plasmin, plasma and pancreatic kallikrein. {ECO:0000269|PubMed:6602050, ECO:0000269|PubMed:6639951}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Domain (1); Modified residue (1); Propeptide (1); Signal peptide (1); Site (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Pyrrolidone carboxylic acid;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | MOD_RES 25; /note=Pyrrolidone carboxylic acid; /evidence=ECO:0000269|PubMed:6639951 |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..24; /evidence=ECO:0000269|PubMed:6639951 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 9,831 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |