| IED ID | IndEnz0002011202 |
| Enzyme Type ID | protease011202 |
| Protein Name |
Kunitz-like toxin PcKuz1 Kunitz-type serine protease inhibitor PcKuz1 PI-sphenopitoxin-Pc1a PI-SPTX-Pc1a |
| Gene Name | |
| Organism | Palythoa caribaeorum (White encrusting zoanthid coral) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Cnidaria Anthozoa (anthozoans) Hexacorallia Zoantharia (zoanthids) Sphenopidae Palythoa Palythoa caribaeorum (White encrusting zoanthid coral) |
| Enzyme Sequence | CMEPKKVGPCRAAMPRFYFNSASNKCEGFTYGGCDANHNNFQSEADCKKAC |
| Enzyme Length | 51 |
| Uniprot Accession Number | P0DQQ9 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Weak serine protease inhibitor that has been tested on both trypsin and elastase (PubMed:29285938). May also act as a neurotoxin by inhibiting voltage-gated potassium channels (Kv) (By similarity). In vivo, is lethal to zebrafish larvae (PubMed:29285938). {ECO:0000250|UniProtKB:P00980, ECO:0000250|UniProtKB:P0DQT3, ECO:0000269|PubMed:29285938}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3) |
| Keywords | Disulfide bond;Nematocyst;Neurotoxin;Protease inhibitor;Secreted;Serine protease inhibitor;Toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305}. Nematocyst {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 5,628 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |