| IED ID |
IndEnz0002011222 |
| Enzyme Type ID |
protease011222 |
| Protein Name |
UPF0758 protein NGR_c13970
|
| Gene Name |
NGR_c13970 |
| Organism |
Sinorhizobium fredii (strain NBRC 101917 / NGR234) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Proteobacteria
Alphaproteobacteria
Hyphomicrobiales
Rhizobiaceae
Sinorhizobium/Ensifer group
Sinorhizobium
Sinorhizobium fredii group
Rhizobium fredii (Sinorhizobium fredii)
Sinorhizobium fredii (strain NBRC 101917 / NGR234)
|
| Enzyme Sequence |
MTKPPPFPEPDDSETADERQFFAQQKTRKLDTVATLGGTGEAHYHGHRDRLRARYREQGDAALADYDILELILFRLIPRRDTKPIAKELLARFGTLSGVFGAPQHLLQEVKGVGEAVALDLKLIATAAQRTLKSELRNKQVLSSWSAVIDYCHAAMAHETKEQFRILFLDKRNALIADEVQQQGTIDHTPVYPREVVKRALELSATALILAHNHPSGDPTPSRADIEMTKLIAEAAKPLGITVHDHVIIGKDGHVSMKGLRLF |
| Enzyme Length |
263 |
| Uniprot Accession Number |
C3MBW4 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
|
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Domain (1); Metal binding (3); Motif (1) |
| Keywords |
Hydrolase;Metal-binding;Metalloprotease;Protease;Reference proteome;Zinc |
| Interact With |
|
| Induction |
|
| Subcellular Location |
|
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
MOTIF 212..225; /note=JAMM motif; /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 |
| Gene Encoded By |
|
| Mass |
29,258 |
| Kinetics |
|
| Metal Binding |
METAL 212; /note=Zinc; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU01182; METAL 214; /note=Zinc; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU01182; METAL 225; /note=Zinc; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 |
| Rhea ID |
|
| Cross Reference Brenda |
|