| IED ID | IndEnz0002011226 |
| Enzyme Type ID | protease011226 |
| Protein Name |
Gag-Pol polyprotein Pr160Gag-Pol Cleaved into: Integrase IN EC 2.7.7.- EC 3.1.-.- Fragment |
| Gene Name | gag-pol |
| Organism | Human immunodeficiency virus type 1 group M subtype D (isolate Z6) (HIV-1) |
| Taxonomic Lineage | Viruses Riboviria Pararnavirae Artverviricota Revtraviricetes Ortervirales Retroviridae Orthoretrovirinae Lentivirus Human immunodeficiency virus 1 HIV-1 unknown group Human immunodeficiency virus type 1 group M subtype D (isolate Z6) (HIV-1) |
| Enzyme Sequence | IPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED |
| Enzyme Length | 148 |
| Uniprot Accession Number | P04586 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | DNA_BIND 83..130; /note=Integrase-type; /evidence=ECO:0000255|PROSITE-ProRule:PRU00506 |
| EC Number | 2.7.7.-; 3.1.-.- |
| Enzyme Function | FUNCTION: [Integrase]: Catalyzes viral DNA integration into the host chromosome, by performing a series of DNA cutting and joining reactions. This enzyme activity takes place after virion entry into a cell and reverse transcription of the RNA genome in dsDNA. The first step in the integration process is 3' processing. This step requires a complex comprising the viral genome, matrix protein, Vpr and integrase. This complex is called the pre-integration complex (PIC). The integrase protein removes 2 nucleotides from each 3' end of the viral DNA, leaving recessed CA OH's at the 3' ends. In the second step, the PIC enters cell nucleus. This process is mediated through integrase and Vpr proteins, and allows the virus to infect a non dividing cell. This ability to enter the nucleus is specific of lentiviruses, other retroviruses cannot and rely on cell division to access cell chromosomes. In the third step, termed strand transfer, the integrase protein joins the previously processed 3' ends to the 5' ends of strands of target cellular DNA at the site of integration. The 5'-ends are produced by integrase-catalyzed staggered cuts, 5 bp apart. A Y-shaped, gapped, recombination intermediate results, with the 5'-ends of the viral DNA strands and the 3' ends of target DNA strands remaining unjoined, flanking a gap of 5 bp. The last step is viral DNA integration into host chromosome. This involves host DNA repair synthesis in which the 5 bp gaps between the unjoined strands are filled in and then ligated. Since this process occurs at both cuts flanking the HIV genome, a 5 bp duplication of host DNA is produced at the ends of HIV-1 integration. Alternatively, Integrase may catalyze the excision of viral DNA just after strand transfer, this is termed disintegration. {ECO:0000250|UniProtKB:P04585}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (4); Chain (2); DNA binding (1); Domain (1); Helix (1); Metal binding (1); Non-terminal residue (1) |
| Keywords | 3D-structure;AIDS;DNA integration;DNA recombination;DNA-binding;Endonuclease;Eukaryotic host gene expression shutoff by virus;Eukaryotic host translation shutoff by virus;Host gene expression shutoff by virus;Host-virus interaction;Hydrolase;Lipid-binding;Magnesium;Metal-binding;Nuclease;Nucleotidyltransferase;Transferase;Viral genome integration;Virus entry into host cell |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | PTM: Specific enzymatic cleavages by the viral protease yield mature proteins. {ECO:0000250}. |
| Signal Peptide | |
| Structure 3D | NMR spectroscopy (2) |
| Cross Reference PDB | 1IHV; 1IHW; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 16,840 |
| Kinetics | |
| Metal Binding | METAL 12; /note=Magnesium; catalytic; for integrase activity; /evidence=ECO:0000250|UniProtKB:P04585 |
| Rhea ID | |
| Cross Reference Brenda |