| IED ID | IndEnz0002011283 |
| Enzyme Type ID | protease011283 |
| Protein Name |
Turripeptide Ici9.1 Turripeptide OL11-like Fragment |
| Gene Name | |
| Organism | Iotyrris cingulifera (Sea snail) (Pleurotoma cingulifera) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Turridae Iotyrris Iotyrris cingulifera (Sea snail) (Pleurotoma cingulifera) |
| Enzyme Sequence | CLSVCSMEYWPVCGSDGKTYPNECHLTSEACMSNTDITVAHVGKCDQ |
| Enzyme Length | 47 |
| Uniprot Accession Number | P0DKM8 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Acts as a neurotoxin by inhibiting an ion channel (By similarity). May also act as a serine protease inhibitor, since it possess the kazal serine protease inhibitor signature. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Domain (1); Non-terminal residue (1); Site (1) |
| Keywords | Disulfide bond;Ion channel impairing toxin;Neurotoxin;Protease inhibitor;Secreted;Serine protease inhibitor;Toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 5,115 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |