| IED ID | IndEnz0002011287 |
| Enzyme Type ID | protease011287 |
| Protein Name |
PI-stichotoxin-Hcr2e PI-SHTX-Hcr2e Kunitz-type serine protease inhibitor InhVJ |
| Gene Name | |
| Organism | Heteractis crispa (Leathery sea anemone) (Radianthus macrodactylus) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Cnidaria Anthozoa (anthozoans) Hexacorallia Actiniaria (sea anemones) Stichodactylidae Heteractis Heteractis crispa (Leathery sea anemone) (Radianthus macrodactylus) |
| Enzyme Sequence | MKGTFLICLILIAGFSFKSTQAGSICLEPKVVGPCTAYFPRFYFDSETGKCTPFIYGGCEGNGNNFETLHACRAICRA |
| Enzyme Length | 78 |
| Uniprot Accession Number | P0DMJ5 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Serine protease inhibitor that specifically inhibits trypsin (Ki=73.8-78 nM) and chymotrypsin (Ki=993 nM) (PubMed:17886436, PubMed:17288251, PubMed:33802055). In vitro, it shows cytoprotective activity in the oxidative stress agent 6-hydroxydopamine (6-OHDA)-induced neurotoxicity model (PubMed:33802055). In this model, it decreases reactive oxygen species (ROS) level, and increases cell viability in a correlated manner (PubMed:33802055). It is possible that the observed effect is due to the ability of this peptides to act as free-radical scavenger (PubMed:33802055). {ECO:0000269|PubMed:17288251, ECO:0000269|PubMed:17886436, ECO:0000269|PubMed:33802055}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Domain (1); Sequence conflict (1); Signal peptide (1); Site (2) |
| Keywords | Direct protein sequencing;Disulfide bond;Nematocyst;Protease inhibitor;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305|PubMed:22851925}. Nematocyst {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..22; /evidence=ECO:0000269|PubMed:22851925 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 8,485 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |