IED ID | IndEnz0002011291 |
Enzyme Type ID | protease011291 |
Protein Name |
WAP four-disulfide core domain protein 18 Extracellular peptidase inhibitor Protein WDNM1 Fragment |
Gene Name | Wfdc18 Expi Wdnm1 |
Organism | Rattus norvegicus (Rat) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) |
Enzyme Sequence | TASVLLLVALIAVGMNITYALFSPTKLEKPGKCPKNPPRSIGTCVELCSGDQSCPNIQKCCSNGCGHVCKSPVF |
Enzyme Length | 74 |
Uniprot Accession Number | P14730 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Involved in the metastatic potential of adenocarcinomas in rat. Could have proteinase inhibiting capacity. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1); Domain (1); Erroneous initiation (1); Non-terminal residue (1); Signal peptide (1) |
Keywords | Protease inhibitor;Reference proteome;Secreted;Signal |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | SIGNAL <1..23; /evidence=ECO:0000255 |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | 16876430; |
Motif | |
Gene Encoded By | |
Mass | 7,740 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |