| IED ID | IndEnz0002011351 |
| Enzyme Type ID | protease011351 |
| Protein Name |
Zinc metalloproteinase-disintegrin-like mikarin EC 3.4.24.- Snake venom metalloproteinase SVMP Fragments |
| Gene Name | |
| Organism | Micropechis ikaheca (New Guinean small-eyed snake) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Elapidae Notechinae Micropechis Micropechis ikaheca (New Guinean small-eyed snake) |
| Enzyme Sequence | TNTPEQDRYLQVKKYLEYVVVDNNMYRNYGNAGPCVMSAEISFEPLQEFSSCDIQEPLSQDIVQPAVCGNYYVEVGGECDCGSPKPCRSACCNAATCKLQREHQCDSGECCEKKDDCDLPEICTGRSAKCSCVISQGDLGYGMVEPGTKCTDGMVCSNEQCVDVQTAAK |
| Enzyme Length | 169 |
| Uniprot Accession Number | P0DJ43 |
| Absorption | |
| Active Site | |
| Activity Regulation | ACTIVITY REGULATION: Inhibited by EDTA, but not by PMSF. {ECO:0000269|PubMed:12485606}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.24.- |
| Enzyme Function | FUNCTION: Snake venom zinc metalloproteinase that calcium-independently catalyzes the conversion of prothrombin (F2) to alpha-thrombin through the formation of a thrombin intermediate. {ECO:0000269|PubMed:12485606}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (6); Domain (2); Motif (1); Non-adjacent residues (4) |
| Keywords | Blood coagulation cascade activating toxin;Direct protein sequencing;Disulfide bond;Hemostasis impairing toxin;Hydrolase;Metal-binding;Metalloprotease;Protease;Prothrombin activator;Secreted;Toxin;Zinc |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 116..118; /note=D/ECD-tripeptide |
| Gene Encoded By | |
| Mass | 18,439 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |