| IED ID | IndEnz0002011367 |
| Enzyme Type ID | protease011367 |
| Protein Name |
Thrombin-like enzyme elegaxobin-1 SVTLE EC 3.4.21.- Elegaxobin I Fibrinogen-clotting enzyme Snake venom serine protease SVSP |
| Gene Name | |
| Organism | Protobothrops elegans (Elegant pitviper) (Trimeresurus elegans) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Viperidae Crotalinae (pit vipers) Protobothrops Protobothrops elegans (Elegant pitviper) (Trimeresurus elegans) |
| Enzyme Sequence | VIGGDECNINEHPFLVLVYYDDYQCGGTLINEEWVLTAAHCNGKNMEIYLGVHSKKVPNKDVQRRVPKEKFFCDSSKTYTKWNKDIMLIRLDRPVRKSAHIAPLSLPSSPPSVGSVCRVMGWGTITSPQETYPDVPHCAKINLLDYSECRAAYPGLPPKSRTLCAGVLEGGKDTCGGDSGGPLICNGQFQGIVSWGGDPCAQPHEPGSYTNVFDHLDWIKGIIAGNTDATCPL |
| Enzyme Length | 233 |
| Uniprot Accession Number | P84788 |
| Absorption | |
| Active Site | ACT_SITE 40; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P12544; ACT_SITE 85; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P12544; ACT_SITE 179; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P12544 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Thrombin-like snake venom serine protease that clots rabbit fibrinogen. Only the beta chain of fibrinogen (FGB) is cleaved, releasing fibrinopeptide B. Incubation with human fibrinogen alpha and beta resulted in cleavage of both fibrinogen chains but generated neither fibrinopeptide A nor fibrinopeptide B. Promotes clotting of rabbit fibrinogen, but not bovine or human fibrinogen. {ECO:0000269|PubMed:10708800}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Disulfide bond (6); Domain (1) |
| Keywords | Blood coagulation cascade activating toxin;Direct protein sequencing;Disulfide bond;Hemostasis impairing toxin;Hydrolase;Protease;Secreted;Serine protease;Toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:10708800, ECO:0000269|PubMed:12076650}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 25,440 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |