| IED ID | IndEnz0002011371 |
| Enzyme Type ID | protease011371 |
| Protein Name |
Thrombin-like enzyme gyroxin B1.3 SVTLE gyroxin B1.3 EC 3.4.21.- Fibrinogen-clotting enzyme Snake venom serine protease SVSP |
| Gene Name | |
| Organism | Crotalus durissus terrificus (South American rattlesnake) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Viperidae Crotalinae (pit vipers) Crotalus Crotalus durissus (tropical rattlesnake) Crotalus durissus terrificus (South American rattlesnake) |
| Enzyme Sequence | MVLIRVLANLLILQLSYAQKSSELVIGGDECNINEHNFLVALYEYWSQSFLCGGTLINGEWVLTAAHCDRKHILIYVGVHDRSVQFDKEQRRFPKEKYFFNCRNNFTKWDKDIMLIRLNKPVSYSEHIAPLSLPSSPPIVGSVCRVMGWGTIKSPQETLPDVPHCANINLLDYEVCRTAHPQFRLPATSRILCAGVLEGGIDTCHRDSGGPLICNGEFQGIVSWGDGPCAQPDKPALYSKVFDHLDWIQNIIAGSETVNCPS |
| Enzyme Length | 262 |
| Uniprot Accession Number | B0FXM1 |
| Absorption | |
| Active Site | ACT_SITE 67; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 112; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 208; /note=Charge relay system; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Thrombin-like snake venom serine protease. Displays a specificity similar to trypsin. Releases only fibrinopeptide A in the conversion of fibrinogen to fibrin. Reversibly increases the permeability of the blood brain barrier (BBB) in mice (PubMed:11137545, PubMed:20637222). Induces the barrel rotation syndrome in mice, which is manifested by gyroxin-like, rapid rolling motions (PubMed:11137545, PubMed:20637222). This syndrome may be due to its effect on BBB permeability, and certainly also to other actions affecting endogenous substrates present in the endothelium, nervous tissues or blood (PubMed:11137545, PubMed:20637222). Also shows a moderate inhibitory activity on the human voltage-gated potassium channel Kv10.1/KCNH1/EAG1 (58% current inhibition at 5 uM) (PubMed:32161292). It blocks Kv10.1/KCNH1/EAG1 in a time and dose-dependent manner and with a mechanism independent of its enzymatic activity (By similarity). It may have a preference in interacting with Kv10.1/KCNH1/EAG1 in its closed state, since the inhibitory effect of the toxin is decreased at more depolarized potentials (By similarity). {ECO:0000250|UniProtKB:A0A0S4FKT4, ECO:0000269|PubMed:11137545, ECO:0000269|PubMed:20637222, ECO:0000269|PubMed:32161292}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Disulfide bond (6); Domain (1); Glycosylation (1); Propeptide (1); Signal peptide (1) |
| Keywords | Blood coagulation cascade activating toxin;Disulfide bond;Glycoprotein;Hemostasis impairing toxin;Hydrolase;Ion channel impairing toxin;Potassium channel impairing toxin;Protease;Secreted;Serine protease;Signal;Toxin;Voltage-gated potassium channel impairing toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..18; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 29,347 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |