| IED ID | IndEnz0002011434 |
| Enzyme Type ID | protease011434 |
| Protein Name |
Thrombin-like enzyme bilineobin SVTLE EC 3.4.21.- Fibrinogen-clotting enzyme Snake venom serine protease SVSP |
| Gene Name | |
| Organism | Agkistrodon bilineatus (Cantil) (Tropical moccasin) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Viperidae Crotalinae (pit vipers) Agkistrodon Agkistrodon bilineatus (Cantil) (Tropical moccasin) |
| Enzyme Sequence | IIGGDECNINEHRFLVALYDVWSGSFLCGGTLINQEWVLTAAHCNMSNIYIYLGMHNQSVQFDDEERRYPKEKYLFRCSKNFTKWDKDIMLIRLNKPVRNSEHIAPLSLPSSPPIVGSVCRVMGWGTITSPNETLPDVPRCVNINLFNYTVCRGVFPRLPERSRILCAGVLEGGIDTCKRDSGGPLICNGQFQGIVSWGPKRCAQPRKPALYSKVFDHLDWIQSIIAGNKTVNCP |
| Enzyme Length | 235 |
| Uniprot Accession Number | Q9PSN3 |
| Absorption | |
| Active Site | ACT_SITE 43; /note=Charge relay system; /evidence=ECO:0000255|PROSITE-ProRule:PRU00274; ACT_SITE 88; /note=Charge relay system; /evidence=ECO:0000255|PROSITE-ProRule:PRU00274; ACT_SITE 182; /note=Charge relay system; /evidence=ECO:0000255|PROSITE-ProRule:PRU00274 |
| Activity Regulation | ACTIVITY REGULATION: Not inhibited by hirudin. {ECO:0000269|PubMed:8470131}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Thrombin-like snake venom serine protease that has coagulant activity by releasing fibrinopeptides A and B from fibrinogen alpha (FGA) and beta (FGB), with a preference for beta chain. {ECO:0000269|PubMed:8470131}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Disulfide bond (6); Domain (1); Glycosylation (6); Sequence conflict (1) |
| Keywords | Blood coagulation cascade activating toxin;Direct protein sequencing;Disulfide bond;Glycoprotein;Hemostasis impairing toxin;Hydrolase;Protease;Secreted;Serine protease;Toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:7726578, ECO:0000269|PubMed:8470131}. |
| Modified Residue | |
| Post Translational Modification | PTM: Glycosylated. {ECO:0000269|PubMed:7726578}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 26,479 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |