| IED ID | IndEnz0002011443 |
| Enzyme Type ID | protease011443 |
| Protein Name |
KappaPI-stichotoxin-Shd2a KappaPI-SHTX-Shd2a Kunitz-type protease inhibitor and potassium channel toxin SHTX III Kunitz-type protease inhibitor and potassium channel toxin SHTX-3 |
| Gene Name | |
| Organism | Stichodactyla haddoni (Saddle carpet anemone) (Haddon's sea anemone) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Cnidaria Anthozoa (anthozoans) Hexacorallia Actiniaria (sea anemones) Stichodactylidae Stichodactyla Stichodactyla haddoni (Saddle carpet anemone) (Haddon's sea anemone) |
| Enzyme Sequence | MAKLYFLLCLALVACLTMATEEMPALCHLQPDVPKCRGYFPRYYYNPEVGKCEQFIYGGCGGNKNNFVSFEACRATCIIPL |
| Enzyme Length | 81 |
| Uniprot Accession Number | B1B5I8 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Dual-function toxin that inhibits both the serine protease trypsin and voltage-gated potassium channels (Kv). {ECO:0000269|PubMed:18243416}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Domain (1); Signal peptide (1); Site (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Ion channel impairing toxin;Nematocyst;Potassium channel impairing toxin;Protease inhibitor;Secreted;Serine protease inhibitor;Signal;Toxin;Voltage-gated potassium channel impairing toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305|PubMed:18243416}. Nematocyst {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000269|PubMed:18243416 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 9,111 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |