IED ID | IndEnz0002011446 |
Enzyme Type ID | protease011446 |
Protein Name |
Kunitz-type serine protease inhibitor HNTX-852 Fragment |
Gene Name | |
Organism | Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Chelicerata Arachnida Araneae (spiders) Mygalomorphae (mygalomorph spiders) Theraphosidae (tarantulas) Haplopelma Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) |
Enzyme Sequence | DPSGSPHIRILPQETFEDICRLPSDSGDCLRFFEMWYFDGTTCTKFVYGGYGGNDNRFPTEKACMKRCAKA |
Enzyme Length | 71 |
Uniprot Accession Number | P0DJ69 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Dual-function toxin that inhibits both serine proteases and voltage-gated potassium channels (Kv). {ECO:0000250}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1); Disulfide bond (2); Domain (1); Non-terminal residue (1); Signal peptide (1); Site (2) |
Keywords | Disulfide bond;Ion channel impairing toxin;Potassium channel impairing toxin;Protease inhibitor;Secreted;Serine protease inhibitor;Signal;Toxin;Voltage-gated potassium channel impairing toxin |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305|PubMed:18923708}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | SIGNAL <1..22; /evidence=ECO:0000250 |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 8,079 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |