| IED ID | IndEnz0002011460 |
| Enzyme Type ID | protease011460 |
| Protein Name |
Zinc metalloproteinase-disintegrin-like crovidisin EC 3.4.24.- Snake venom metalloproteinase SVMP Fragments |
| Gene Name | |
| Organism | Crotalus viridis viridis (Prairie rattlesnake) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Viperidae Crotalinae (pit vipers) Crotalus Crotalus viridis (Western rattlesnake) Crotalus viridis viridis (Prairie rattlesnake) |
| Enzyme Sequence | AMVTKNNGDLDKSGTECRLYCKDNSPGQNNSCKMFYSNEDEHKGMVLPGTK |
| Enzyme Length | 51 |
| Uniprot Accession Number | P0C7N3 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.24.- |
| Enzyme Function | FUNCTION: Snake venom zinc metalloproteinase-disintegrin-like that blocks the interaction between platelets and collagen fibers through its binding to collagen fibers, resulting in the blockade of collagen-mediated platelet functions such as adhesion, release reaction, thromboxane formation, and aggregation. Binds selectively to collagen type I with high affinity. Also exerts proteolytic activity to matrix. {ECO:0000269|PubMed:15037024, ECO:0000269|PubMed:9395771}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (2); Glycosylation (1); Non-adjacent residues (2); Non-terminal residue (2) |
| Keywords | Apoptosis;Direct protein sequencing;Glycoprotein;Hemostasis impairing toxin;Hydrolase;Metal-binding;Metalloprotease;Platelet aggregation inhibiting toxin;Protease;Secreted;Toxin;Zinc |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 5,657 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |