| IED ID | IndEnz0002011476 |
| Enzyme Type ID | protease011476 |
| Protein Name |
Kunitz-type serine protease inhibitor BmKTT-3 Delta-KTx 1.2 |
| Gene Name | |
| Organism | Mesobuthus martensii (Manchurian scorpion) (Buthus martensii) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Chelicerata Arachnida Scorpiones Buthida Buthoidea Buthidae Mesobuthus Mesobuthus martensii (Manchurian scorpion) (Buthus martensii) |
| Enzyme Sequence | KHGSINCRLPPERGPCRGNITKYYYHNESRTCRTFSYGGCEGNSNNFRNRHYCMKYCARKRHGWLGTGWI |
| Enzyme Length | 70 |
| Uniprot Accession Number | P0DJ47 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Dual-function toxin that inhibits 85% of the activity of trypsin at a molar ratio of 4:1 with a dissociation constant of 760 nM, and that inhibits mKv1.3/KCNA3 potassium channel currents, but very weakly. {ECO:0000269|PubMed:22354971}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Domain (1); Site (1) |
| Keywords | Disulfide bond;Ion channel impairing toxin;Potassium channel impairing toxin;Protease inhibitor;Secreted;Serine protease inhibitor;Toxin;Voltage-gated potassium channel impairing toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 8,261 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |