| IED ID | IndEnz0002011558 |
| Enzyme Type ID | protease011558 |
| Protein Name |
Whey acidic protein WAP Whey phosphoprotein |
| Gene Name | Wap |
| Organism | Rattus norvegicus (Rat) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) |
| Enzyme Sequence | MRCSISLVLGLLALEVALARNLQEHVFNSVQSMCSDDSFSEDTECINCQTNEECAQNDMCCPSSCGRSCKTPVNIEVQKAGRCPWNPIQMIAAGPCPKDNPCSIDSDCSGTMKCCKNGCIMSCMDPEPKSPTVISFQ |
| Enzyme Length | 137 |
| Uniprot Accession Number | P01174 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Could be a protease inhibitor. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (8); Domain (2); Sequence conflict (15); Signal peptide (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Milk protein;Protease inhibitor;Reference proteome;Repeat;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | PTM: Contains 8 disulfide bonds. |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000269|PubMed:6955785 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 14,827 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |