| IED ID | IndEnz0002011561 |
| Enzyme Type ID | protease011561 |
| Protein Name |
PI-stichotoxin-Hcr2m PI-SHTX-Hcr2m Kunitz-type serine protease inhibitor HCGS1.10 |
| Gene Name | |
| Organism | Heteractis crispa (Leathery sea anemone) (Radianthus macrodactylus) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Cnidaria Anthozoa (anthozoans) Hexacorallia Actiniaria (sea anemones) Stichodactylidae Heteractis Heteractis crispa (Leathery sea anemone) (Radianthus macrodactylus) |
| Enzyme Sequence | GSICLEPKVVGPCTAYLRRFYFDSETGKCTPFIYGGCEGNGNNFETLRACRAICRA |
| Enzyme Length | 56 |
| Uniprot Accession Number | P0DV03 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: This recombinant serine protease inhibitor inhibits trypsin (Ki=210 nM) (Ref.3). In contrast to other sea anemone serine protease inhibitors, it does not significantly blocks histamine influence on intracellular calcium concentration in murine bone marrow-derived macrophages (tested at 1 and 10 uM) (Ref.3). In vitro, it shows cytoprotective activity in the oxidative stress agent 6-hydroxydopamine (6-OHDA)-induced neurotoxicity model (PubMed:33802055). In this model, it decreases reactive oxygen species (ROS) levels, and increases cell viability in a correlated manner (PubMed:33802055). It is possible that the observed effect is due to the ability of this peptides to act as free-radical scavenger (PubMed:33802055). In vivo, it shows analgesic activity, since it increases hot plate and tail flick withdrawal latencies, when using a mice thermal pain stimulation model (PubMed:25937220). {ECO:0000269|PubMed:25937220, ECO:0000269|Ref.3}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Domain (1); Site (1) |
| Keywords | Disulfide bond;Ion channel impairing toxin;Nematocyst;Protease inhibitor;Secreted;Serine protease inhibitor;Toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305}. Nematocyst {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 6,157 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |