| IED ID | IndEnz0002011572 |
| Enzyme Type ID | protease011572 |
| Protein Name |
Proteasome activator complex subunit 3 Activator of multicatalytic protease subunit 3 Proteasome activator 28 subunit gamma PA28g PA28gamma |
| Gene Name | PSME3 RCJMB04_15e19 RCJMB04_5i13 |
| Organism | Gallus gallus (Chicken) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Archelosauria Archosauria Dinosauria Saurischia Theropoda Coelurosauria Aves Neognathae Galloanserae Galliformes Phasianidae (turkeys) Phasianinae Gallus Gallus gallus (Chicken) |
| Enzyme Sequence | MASLLKVDPEVKLKVDSFRERITSEAEDLVANFFPKKLLELDGFLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPNMKKRKLEDREETFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY |
| Enzyme Length | 254 |
| Uniprot Accession Number | Q5F3J5 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Implicated in immunoproteasome assembly and required for efficient antigen processing. The PA28 activator complex enhances the generation of class I binding peptides by altering the cleavage pattern of the proteasome (By similarity). {ECO:0000250|UniProtKB:P61290}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Modified residue (3); Sequence conflict (1) |
| Keywords | Acetylation;Proteasome;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | MOD_RES 6; /note=N6-acetyllysine; /evidence=ECO:0000250; MOD_RES 14; /note=N6-acetyllysine; /evidence=ECO:0000250; MOD_RES 195; /note=N6-acetyllysine; by P300/CBP; /evidence=ECO:0000250 |
| Post Translational Modification | PTM: Acetylation at the major site Lys-195 is important for oligomerization and ability to degrade its target substrates. Deacetylated by SIRT1 (By similarity). {ECO:0000250}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 29,481 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |