| IED ID | IndEnz0002011574 |
| Enzyme Type ID | protease011574 |
| Protein Name |
Proteasome subunit beta EC 3.4.25.1 20S proteasome beta subunit Proteasome core protein PsmB |
| Gene Name | psmB PTO0686 |
| Organism | Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) |
| Taxonomic Lineage | cellular organisms Archaea Candidatus Thermoplasmatota Thermoplasmata Thermoplasmatales Picrophilaceae Picrophilus Picrophilus torridus Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) |
| Enzyme Sequence | MEVLKTGTTTVGITAGDYVIMGTDSRATMENFISNKNAQKLYQIDNYAAMTIAGLVGDAQVLVRYMKAEMELYRVQRKVSMPIDAAATLLSNMLNQTKFYPYMVQLLVGGYDTKPHIFSIDAAGGSVEDIYASTGSGSPFVYGVLEAEYQKNMSLDDGINLVIKAISAAKQRDSASGNMLQLGVVDPKKGFYYLSEDEILSRLKKLKLQL |
| Enzyme Length | 210 |
| Uniprot Accession Number | Q6L181 |
| Absorption | |
| Active Site | ACT_SITE 8; /note=Nucleophile; /evidence=ECO:0000255|HAMAP-Rule:MF_02113 |
| Activity Regulation | ACTIVITY REGULATION: The formation of the proteasomal ATPase PAN-20S proteasome complex, via the docking of the C-termini of PAN into the intersubunit pockets in the alpha-rings, triggers opening of the gate for substrate entry. Interconversion between the open-gate and close-gate conformations leads to a dynamic regulation of the 20S proteasome proteolysis activity. {ECO:0000255|HAMAP-Rule:MF_02113}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Cleavage of peptide bonds with very broad specificity.; EC=3.4.25.1; Evidence={ECO:0000255|HAMAP-Rule:MF_02113}; |
| DNA Binding | |
| EC Number | 3.4.25.1 |
| Enzyme Function | FUNCTION: Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation. {ECO:0000255|HAMAP-Rule:MF_02113}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Propeptide (1) |
| Keywords | Autocatalytic cleavage;Cytoplasm;Hydrolase;Protease;Proteasome;Reference proteome;Threonine protease;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000255|HAMAP-Rule:MF_02113}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 23,041 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |