| IED ID |
IndEnz0002011616 |
| Enzyme Type ID |
protease011616 |
| Protein Name |
Outer membrane lipoprotein virB7
|
| Gene Name |
virB7 |
| Organism |
Agrobacterium tumefaciens (strain 15955) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Proteobacteria
Alphaproteobacteria
Hyphomicrobiales
Rhizobiaceae
Rhizobium/Agrobacterium group
Agrobacterium
Agrobacterium tumefaciens complex
Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter)
Agrobacterium tumefaciens (strain 15955)
|
| Enzyme Sequence |
MKYCLLCLVVALSGCQTNDTIASCKGPIFPLNVGRWQPTPSDLQLRNSGGRYDGA |
| Enzyme Length |
55 |
| Uniprot Accession Number |
P0A3W5 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Is essential for the biogenesis of the T-pilus, which is required for virulence and T-DNA transfer to plant cells. When is associated with virB9, might function as a nucleation center for recruitment of VirB proteins during assembly of the T-DNA transfer machine (By similarity). {ECO:0000250}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Disulfide bond (2); Lipidation (2); Signal peptide (1) |
| Keywords |
Cell outer membrane;Crown gall tumor;Disulfide bond;Lipoprotein;Membrane;Palmitate;Plasmid;Signal;Virulence |
| Interact With |
|
| Induction |
|
| Subcellular Location |
SUBCELLULAR LOCATION: Cell outer membrane; Lipid-anchor. Note=Also associated with the T-pilus when is a homodimer, possibly at the pilus base. {ECO:0000250}. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
SIGNAL 1..14; /evidence=ECO:0000305 |
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
Plasmid pTi15955 |
| Mass |
5,930 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|