| IED ID | IndEnz0002011631 |
| Enzyme Type ID | protease011631 |
| Protein Name |
Secreted effector PIT2 Proteins important for tumors 2 |
| Gene Name | PIT2 UMAG_01375 |
| Organism | Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Basidiomycota Ustilaginomycotina Ustilaginomycetes Ustilaginales Ustilaginaceae Ustilago Ustilago maydis (Corn smut fungus) Ustilago maydis (strain 521 / FGSC 9021) (Corn smut fungus) |
| Enzyme Sequence | MLFRSAFVLLIVAFASACLVQHVQAKQIPVRRSLSTDASMSSAAGKLNRRWWFGFTGSLGKEPDNGQVQIKIIPDALIIKNPPANKDDLNKLIENLKRKHPRFKTVVMPTDPNGDVVIWE |
| Enzyme Length | 120 |
| Uniprot Accession Number | A0A0D1EAR7 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Secreted effector required for virulence (PubMed:21692877, PubMed:23459172). Functions as an inhibitor of a set of apoplastic maize papain-like cysteine proteases (PLCPs) including CP1A, CP1B, XCP2 and CP2, whose activity is directly linked with salicylic-acid-associated plant defenses (PubMed:23459172). Acts as a substrate mimicking molecule for apoplastic PLCPs and its processing releases the embedded inhibitor peptide PID14, which in turn blocks PLCPs to modulate host immunity (PubMed:30952847). {ECO:0000269|PubMed:21692877, ECO:0000269|PubMed:23459172, ECO:0000269|PubMed:30952847}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Mutagenesis (3); Region (1); Signal peptide (1) |
| Keywords | Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | INDUCTION: Expression is highly up-regulated during all stages of pathogenic development (PubMed:21692877). Expression is positively regulated by the unfolded protein response (UPR) signaling via the binding of CIB1 to the UPRE motif localized at the PIT1/PIT2 promoter (PubMed:27093436). {ECO:0000269|PubMed:21692877, ECO:0000269|PubMed:27093436}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:21692877, ECO:0000269|PubMed:27093436}. Note=Secreted to the biotrophic interface. {ECO:0000269|PubMed:21692877}. |
| Modified Residue | |
| Post Translational Modification | PTM: Cleaved by host target papain-like cysteine proteases (PLCPs) to release the embedded inhibitor peptide PID14. {ECO:0000269|PubMed:30952847}. |
| Signal Peptide | SIGNAL 1..25; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 13,424 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |