IED ID | IndEnz0002011692 |
Enzyme Type ID | protease011692 |
Protein Name |
Proteasome subunit beta 2 EC 3.4.25.1 20S proteasome beta subunit 2 Proteasome core protein PsmB 2 |
Gene Name | psmB2 Tneu_0916 |
Organism | Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / NBRC 100436 / V24Sta) (Thermoproteus neutrophilus) |
Taxonomic Lineage | cellular organisms Archaea TACK group Crenarchaeota Thermoprotei Thermoproteales Thermoproteaceae Pyrobaculum Pyrobaculum neutrophilum Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / NBRC 100436 / V24Sta) (Thermoproteus neutrophilus) |
Enzyme Sequence | MGEEFQVGATAVGIRAKDGVVLAAEKRVSYGFYTLSTAGKKVFIVNDKLAIASAGIIADMQALAKILKLNARSYELEVKKKPTVKAMAKLLSVVMFSRRFMPFYAEVLVGGVDEEGPHLIVMDPLGSLIEDNYAALGTGAKLAVSLLDASYRPDMTVEEAKKLAVQAVKAAIERDPVSGGGIDLVVVDGGGAREEEVKVQVVI |
Enzyme Length | 203 |
Uniprot Accession Number | B1YDJ0 |
Absorption | |
Active Site | ACT_SITE 10; /note=Nucleophile; /evidence=ECO:0000255|HAMAP-Rule:MF_02113 |
Activity Regulation | ACTIVITY REGULATION: The formation of the proteasomal ATPase PAN-20S proteasome complex, via the docking of the C-termini of PAN into the intersubunit pockets in the alpha-rings, triggers opening of the gate for substrate entry. Interconversion between the open-gate and close-gate conformations leads to a dynamic regulation of the 20S proteasome proteolysis activity. {ECO:0000255|HAMAP-Rule:MF_02113}. |
Binding Site | |
Calcium Binding | |
catalytic Activity | CATALYTIC ACTIVITY: Reaction=Cleavage of peptide bonds with very broad specificity.; EC=3.4.25.1; Evidence={ECO:0000255|HAMAP-Rule:MF_02113}; |
DNA Binding | |
EC Number | 3.4.25.1 |
Enzyme Function | FUNCTION: Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation. {ECO:0000255|HAMAP-Rule:MF_02113}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Active site (1); Chain (1); Propeptide (1) |
Keywords | Autocatalytic cleavage;Cytoplasm;Hydrolase;Protease;Proteasome;Threonine protease;Zymogen |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000255|HAMAP-Rule:MF_02113}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 21,556 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |