| IED ID | IndEnz0002011694 |
| Enzyme Type ID | protease011694 |
| Protein Name |
Proteasome subunit alpha 20S proteasome alpha subunit Proteasome core protein PrcA |
| Gene Name | prcA Francci3_2626 |
| Organism | Frankia casuarinae (strain DSM 45818 / CECT 9043 / CcI3) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Frankiales Frankiaceae Frankia Frankia casuarinae (strain DSM 45818 / CECT 9043 / CcI3) |
| Enzyme Sequence | MTMPFGYASPEQQVRDKSEYARKGIARGRSVVVLTYENGILFVAENPSATLHKISEIYDRIAFAAVGKYNEFENLRTAGIRLMDSRGYMYDRRDVTSRALANAYAQTLGAIFSESVKPYEVEIVVAEVGTSIADDQIYRLTYDGSIADERGFVAIGGASEQVTTSLKEHHRDGQPLAEALRVAVQALTVGVPPGLPQNGERVLAAANLEVGMLDRTRTRRMFKRIVGPALEGLLAQTSAT |
| Enzyme Length | 240 |
| Uniprot Accession Number | Q2J9Q4 |
| Absorption | |
| Active Site | |
| Activity Regulation | ACTIVITY REGULATION: The formation of the proteasomal ATPase ARC-20S proteasome complex, likely via the docking of the C-termini of ARC into the intersubunit pockets in the alpha-rings, may trigger opening of the gate for substrate entry. Interconversion between the open-gate and close-gate conformations leads to a dynamic regulation of the 20S proteasome proteolysis activity. {ECO:0000255|HAMAP-Rule:MF_00289}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation. {ECO:0000255|HAMAP-Rule:MF_00289}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Protein degradation; proteasomal Pup-dependent pathway. {ECO:0000255|HAMAP-Rule:MF_00289}. |
| nucleotide Binding | |
| Features | Chain (1); Erroneous initiation (1) |
| Keywords | Cytoplasm;Proteasome;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000255|HAMAP-Rule:MF_00289}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 26,276 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |