| IED ID |
IndEnz0002011758 |
| Enzyme Type ID |
protease011758 |
| Protein Name |
Thrombin inhibitor rhodniin
|
| Gene Name |
|
| Organism |
Rhodnius prolixus (Triatomid bug) |
| Taxonomic Lineage |
cellular organisms
Eukaryota
Opisthokonta
Metazoa
Eumetazoa
Bilateria
Protostomia
Ecdysozoa
Panarthropoda
Arthropoda
Mandibulata
Pancrustacea
Hexapoda
Insecta
Dicondylia
Pterygota (winged insects)
Neoptera
Paraneoptera
Hemiptera
Prosorrhyncha (bugs)
Heteroptera (true bugs)
Euheteroptera
Neoheteroptera
Panheteroptera
Cimicomorpha
Reduvioidea
Reduviidae (assassin bugs)
Triatominae (kissing bugs)
Rhodnius
Rhodnius prolixus (Triatomid bug)
|
| Enzyme Sequence |
EGGEPCACPHALHRVCGSDGETYSNPCTLNCAKFNGKPELVKVHDGPCEPDEDEDVCQECDGDEYKPVCGSDDITYDNNCRLECASISSSPGVELKHEGPCRT |
| Enzyme Length |
103 |
| Uniprot Accession Number |
Q06684 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Thrombin-specific inhibitor. Appears to form 1:1 complexes with thrombin. Prevents blood clotting to allow the insect to feed on blood. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Beta strand (7); Chain (1); Disulfide bond (6); Domain (2); Helix (4); Site (1); Turn (3) |
| Keywords |
3D-structure;Blood coagulation;Direct protein sequencing;Disulfide bond;Hemostasis;Protease inhibitor;Reference proteome;Repeat;Secreted;Serine protease inhibitor |
| Interact With |
|
| Induction |
|
| Subcellular Location |
SUBCELLULAR LOCATION: Secreted. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
X-ray crystallography (2) |
| Cross Reference PDB |
1TBQ;
1TBR;
|
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
11,079 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|