IED ID | IndEnz0002011782 |
Enzyme Type ID | protease011782 |
Protein Name |
Transposon Ty1-LR3 Gag polyprotein Gag-p49 Transposon Ty1 protein A TY1A TYA p58 Cleaved into: Capsid protein CA Gag-p45 p54 ; Gag-p4 |
Gene Name | TY1A-LR3 YLRWTy1-3 GAG YLR227W-A L8083.11 |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Saccharomycotina (true yeasts) Saccharomycetes Saccharomycetales Saccharomycetaceae Saccharomyces Saccharomyces cerevisiae (Baker's yeast) Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
Enzyme Sequence | MESQQLSQHSHISHGSACASVTSKEVHTNQDPLDVSASKTEECEKASTKANSQQTTTPASSAVPENPHHASPQPASVPPPQNGPYPQQCMMTQNQANPSGWSFYGHPSMIPYTPYQMSPMYFPPGPQSQFPQYPSSVGTPLSTPSPESGNTFTDSSSADSDMTSTKKYVRPPPMLTSPNDFPNWVKTYIKFLQNSNLGGIIPTVNGKPVRQITDDELTFLYNTFQIFAPSQFLPTWVKDILSVDYTDIMKILSKSIEKMQSDTQEANDIVTLANLQYNGSTPADAFETKVTNIIDRLNNNGIHINNKVACQLIMRGLSGEYKFLRYTRHRHLNMTVAELFLDIHAIYEEQQGSRNSKPNYRRNLSDEKNDSRSYTNTTKPKVIARNPQKTNNSKSKTARAHNVSTSNNSPSTDNDSISKSTTEPIQLNNKHDLHLRPGTY |
Enzyme Length | 440 |
Uniprot Accession Number | P0CX75 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Capsid protein (CA) is the structural component of the virus-like particle (VLP), forming the shell that encapsulates the retrotransposons dimeric RNA genome. The particles are assembled from trimer-clustered units and there are holes in the capsid shells that allow for the diffusion of macromolecules. CA has also nucleocapsid-like chaperone activity, promoting primer tRNA(i)-Met annealing to the multipartite primer-binding site (PBS), dimerization of Ty1 RNA and initiation of reverse transcription (By similarity). {ECO:0000250}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (2); Compositional bias (6); Modified residue (1); Peptide (1); Region (4); Sequence conflict (1); Site (1) |
Keywords | Cytoplasm;Phosphoprotein;RNA-binding;Reference proteome;Ribosomal frameshifting;Transposable element |
Interact With | |
Induction | INDUCTION: Ty1-LR3 is a highly expressed element. Induced under amino acid starvation conditions by GCN4. {ECO:0000269|PubMed:11884596}. |
Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. |
Modified Residue | MOD_RES 416; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:Q12441 |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | 22998189; 23226439; 24603646; |
Motif | |
Gene Encoded By | |
Mass | 48,993 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |