| IED ID | IndEnz0002011798 |
| Enzyme Type ID | protease011798 |
| Protein Name |
Transcription factor UDT1 Basic helix-loop-helix protein 164 OsbHLH164 Protein UNDEVELOPED TAPETUM 1 |
| Gene Name | UDT1 BHLH164 Os07g0549600 LOC_Os07g36460 OsJ_24663 P0534A03.125 |
| Organism | Oryza sativa subsp. japonica (Rice) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae Liliopsida Petrosaviidae commelinids Poales Poaceae BOP clade Oryzoideae Oryzeae Oryzinae Oryza Oryza sativa (Rice) Oryza sativa subsp. japonica (Rice) |
| Enzyme Sequence | MPRRARARGGGGGGGEEVKVEDDFIDSVLNFGGGGGGEEDGDDGEEEQQQQQAAAAAMGKEFKSKNLEAERRRRGRLNGNIFALRAVVPKITKMSKEATLSDAIEHIKNLQNEVLELQRQLGDSPGEAWEKQCSASCSESFVPTENAHYQGQVELISLGSCKYNLKIFWTKRAGLFTKVLEALCSYKVQVLSLNTISFYGYAESFFTIEVKGEQDVVMVELRSLLSSIVEVPSI |
| Enzyme Length | 234 |
| Uniprot Accession Number | B9FXT3 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Transcription factor that plays a crucial role in tapetum development. Required for male fertility and pollen differentiation within the developing anther. Plays a major role in maintaining tapetum development, starting in early meiosis. Required for pollen mother cell meiosis. May regulate the anther-specific cysteine protease CP1 and lipid-transfer proteins C4 and C6 (PubMed:16141453). Required for anther development. Functions in parallel with GAMYB to regulate early anther development. Functions upstream of the transcription factor TDR and may positively regulate its transcription (PubMed:20590996). {ECO:0000269|PubMed:16141453, ECO:0000269|PubMed:20590996}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1); Erroneous gene model prediction (2); Region (3); Sequence conflict (4) |
| Keywords | Developmental protein;Nucleus;Reference proteome;Transcription;Transcription regulation |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Nucleus {ECO:0000255|PROSITE-ProRule:PRU00981, ECO:0000269|PubMed:16141453}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 25,675 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |