| IED ID | IndEnz0002011801 |
| Enzyme Type ID | protease011801 |
| Protein Name |
Ubiquitin carboxyl-terminal hydrolase EC 3.4.19.12 |
| Gene Name | UCH1 At5g16310 MQK4.3 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MSWLPVESDPGIFTEIIQQMQVKGVQVEELYSLDFNSLDEIRPVYGLILLYKWRPEEKENRVVITEPNPNFFFASQIINNACATQAILSVLMNSSSIDIGSELSELKQFAKEFPPELKGLAINNNEAIRAAHNTFARPDPSSIMEDEELAAAKNLDEDDDVYHYISYLPVDGILYELDGLKEGPISLGQCLGEPEGIEWLRMVQPVVQEQIDRYSQNEIRFSLLAVVKNRKEMYVAELKEYQRKRERVLQQLGALQADKYAEKSSYEALDRELSEVNIGIETVSQKIVMEEEKSKNWKKENMRRKHNYVPFLFNFLKILADKKKLKPLIAKHHP |
| Enzyme Length | 334 |
| Uniprot Accession Number | Q9FFF2 |
| Absorption | |
| Active Site | ACT_SITE 82; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:P09936; ACT_SITE 163; /note=Proton donor; /evidence=ECO:0000250|UniProtKB:P09936 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; Evidence={ECO:0000305}; |
| DNA Binding | |
| EC Number | 3.4.19.12 |
| Enzyme Function | FUNCTION: Ubiquitin-protein hydrolase involved in the release of ubiquitin attached via both peptide and isopeptide linkages. Able to cleave 'Lys-48'-linked polyubiquitin chains. Involved in the direct or indirect regulation of AUX/IAA proteins stability (Probable). Acts as a linker between the TREX-2 complex and 26S proteasome (PubMed:22951400). {ECO:0000269|PubMed:22951400, ECO:0000303|PubMed:17559514}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Site (1) |
| Keywords | Cytoplasm;Hydrolase;Nucleus;Protease;Reference proteome;Thiol protease;Ubl conjugation pathway |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:17559514, ECO:0000269|PubMed:22951400}. Cytoplasm {ECO:0000269|PubMed:17559514, ECO:0000269|PubMed:22951400}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 21798944; 31745110; |
| Motif | |
| Gene Encoded By | |
| Mass | 38,539 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |