| IED ID | IndEnz0002011825 |
| Enzyme Type ID | protease011825 |
| Protein Name |
Kunitz-type serine protease inhibitor textilinin-2 Txln-2 |
| Gene Name | |
| Organism | Pseudonaja textilis textilis (Eastern brown snake) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Elapidae Acanthophiinae Pseudonaja Pseudonaja textilis (Eastern brown snake) Pseudonaja textilis textilis (Eastern brown snake) |
| Enzyme Sequence | MSSGGLLLLLGLLTLWEVLTPVSSKDRPELCELPPDTGPCRVRFPSFYYNPDEQKCLEFIYGGCEGNANNFITKEECESTCAA |
| Enzyme Length | 83 |
| Uniprot Accession Number | Q90WA0 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Serine protease inhibitor that inhibits plasmin (Ki=2.2 nM), and reduces blood loss in the mouse tail vein blood loss model. {ECO:0000269|PubMed:10847427, ECO:0000269|PubMed:12406072}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Domain (1); Signal peptide (1); Site (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..24; /evidence=ECO:0000269|PubMed:10847427 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 9,179 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |