Detail Information for IndEnz0002011865
IED ID IndEnz0002011865
Enzyme Type ID protease011865
Protein Name Proteasome subunit beta 1
EC 3.4.25.1
20S proteasome beta subunit 1
Proteasome core protein PsmB 1
Gene Name psmB1 LD85_1499
Organism Sulfolobus islandicus (strain L.D.8.5 / Lassen #2)
Taxonomic Lineage cellular organisms Archaea TACK group Crenarchaeota Thermoprotei Sulfolobales Sulfolobaceae Sulfolobus Sulfolobus islandicus Sulfolobus islandicus (strain L.D.8.5 / Lassen #2)
Enzyme Sequence MVIMGNELQLENKILKGTTTVGIKVNDGVVLAADRRASAGFFVANKMVRKVLYITDKIGITTAGSVADLQFIYDVLKNIYHYNSITKYGPISIKGIATRLANVLSATKYFPYIVQILIGGYDDQPRLFNLDYLGDITEENYVATGSGSPVAMGVLEDEYNPKMTLDEAADLAKRAVFSAIKRDSFTGTGVIVAKIHSKGHEELEFYLNKKV
Enzyme Length 211
Uniprot Accession Number D2PK63
Absorption
Active Site ACT_SITE 18; /note=Nucleophile; /evidence=ECO:0000255|HAMAP-Rule:MF_02113
Activity Regulation ACTIVITY REGULATION: The formation of the proteasomal ATPase PAN-20S proteasome complex, via the docking of the C-termini of PAN into the intersubunit pockets in the alpha-rings, triggers opening of the gate for substrate entry. Interconversion between the open-gate and close-gate conformations leads to a dynamic regulation of the 20S proteasome proteolysis activity. {ECO:0000255|HAMAP-Rule:MF_02113}.
Binding Site
Calcium Binding
catalytic Activity CATALYTIC ACTIVITY: Reaction=Cleavage of peptide bonds with very broad specificity.; EC=3.4.25.1; Evidence={ECO:0000255|HAMAP-Rule:MF_02113};
DNA Binding
EC Number 3.4.25.1
Enzyme Function FUNCTION: Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation. {ECO:0000255|HAMAP-Rule:MF_02113}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Active site (1); Chain (1); Propeptide (1)
Keywords Autocatalytic cleavage;Cytoplasm;Hydrolase;Protease;Proteasome;Threonine protease;Zymogen
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Cytoplasm {ECO:0000255|HAMAP-Rule:MF_02113}.
Modified Residue
Post Translational Modification
Signal Peptide
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif
Gene Encoded By
Mass 23,197
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda