| IED ID | IndEnz0002011883 |
| Enzyme Type ID | protease011883 |
| Protein Name |
Trypsin-like protease EC 3.4.21.- |
| Gene Name | |
| Organism | Streptomyces glaucescens |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Streptomycetales Streptomycetaceae Streptomyces Streptomyces glaucescens |
| Enzyme Sequence | MTHTTTIAAKRGGLALAKKAAAAGAVALAVASLQPVSAAHAADARVIGGKPAAQNEFPFMVHLSMGCGGALYKKDIVLTAAHCMDGSGNNTRITVTAGVADLNSSGAIKVKSTKVKVAPGYDGVGKDWALIKLAKPIDRPTLKIATTAKYNRGTFTIAGWGDVREGAGTGTTKLQKANVPFVSDRACKWHYGNRLVPKQELCAGYASGGIDTCQGDSGGPMFRKDDAGKWIQVGIVSWGDGCARSGVPGVYTEVSTFAKDIAKAASAL |
| Enzyme Length | 268 |
| Uniprot Accession Number | Q54179 |
| Absorption | |
| Active Site | ACT_SITE 82; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 127; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 217; /note=Charge relay system; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Protease that shows preferential cleavage after Arg and Lys residues. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Disulfide bond (3); Domain (1); Propeptide (1); Signal peptide (1); Site (1) |
| Keywords | Disulfide bond;Hydrolase;Protease;Serine protease;Signal;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..41; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 27,551 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |