| IED ID | IndEnz0002011890 |
| Enzyme Type ID | protease011890 |
| Protein Name |
PI-stichotoxin-Hcr2j PI-SHTX-Hcr2j Kunitz-peptide HCIQ4c7 Fragment |
| Gene Name | iq4c7 |
| Organism | Heteractis crispa (Leathery sea anemone) (Radianthus macrodactylus) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Cnidaria Anthozoa (anthozoans) Hexacorallia Actiniaria (sea anemones) Stichodactylidae Heteractis Heteractis crispa (Leathery sea anemone) (Radianthus macrodactylus) |
| Enzyme Sequence | GFYFRSIQGFYFKRIQGNICSEPKKVGRCRESFPRFYFDSETGKCTPFIYGGCGGNGNNFETLHACRAICRA |
| Enzyme Length | 72 |
| Uniprot Accession Number | A0A6B7FA07 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Serine protease inhibitor that acts on trypsin (Ki=190 nM) and to elastase (PubMed:32144281). Does not bind to alpha-chymotrypsin, cathepsin G, and kallikrein (PubMed:32144281). {ECO:0000269|PubMed:32144281}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Domain (1); Non-terminal residue (1); Propeptide (1); Signal peptide (1); Site (2) |
| Keywords | Cleavage on pair of basic residues;Disulfide bond;Nematocyst;Protease inhibitor;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:P31713}. Nematocyst {ECO:0000250|UniProtKB:P31713}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL <1..9; /evidence=ECO:0000305 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 8,206 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |