| IED ID | IndEnz0002011926 |
| Enzyme Type ID | protease011926 |
| Protein Name |
mRNA interferase toxin YafO EC 3.1.-.- Endoribonuclease YafO Toxin YafO |
| Gene Name | yafO b0233 JW0223 |
| Organism | Escherichia coli (strain K12) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli Escherichia coli (strain K12) |
| Enzyme Sequence | MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRTNDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF |
| Enzyme Length | 132 |
| Uniprot Accession Number | Q47157 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.1.-.- |
| Enzyme Function | FUNCTION: Toxic component of a type II toxin-antitoxin (TA) system. A translation-dependent mRNA interferase. Overexpression causes cessation of cell growth and inhibits cell proliferation via inhibition of translation; this blockage is overcome by subsequent expression of antitoxin YafN. Overexpression causes cleavage of a number of mRNAs in a ribosome-dependent fashion. YafO binding to the 50S ribosomal subunit in the translation complex induces mRNA cleavage 3' to the region protected by the ribosome; YafO alone is not able to digest mRNA. {ECO:0000269|PubMed:19617347, ECO:0000269|PubMed:19943910}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1) |
| Keywords | DNA damage;DNA repair;Endonuclease;Hydrolase;Nuclease;RNA-binding;Reference proteome;SOS response;Stress response;Toxin-antitoxin system |
| Interact With | Q47156 |
| Induction | INDUCTION: Induced by amino acid starvation, glucose starvation, the DNA cross-linker mitomycin C (SOS response) and when translation is blocked. Induction is decreased in the absence of the Lon protease suggesting, by homology to other toxin-antitoxin systems, that Lon may degrade the YafN antitoxin. Transcription is negatively regulated by the cognate locus, probably by YafN. A member of the dinB-yafNOP operon; it has 2 promoters, 1 upstream of dinB and 1 specific for yafN-yfaO. {ECO:0000269|PubMed:12813093, ECO:0000269|PubMed:19943910}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 14594833; 16606699; |
| Motif | |
| Gene Encoded By | |
| Mass | 15,488 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |