| IED ID | IndEnz0002011979 |
| Enzyme Type ID | protease011979 |
| Protein Name |
Ubiquitin carboxyl-terminal hydrolase isozyme L5 UCH-L5 EC 3.4.19.12 Ubiquitin C-terminal hydrolase UCH37 Ubiquitin thioesterase L5 |
| Gene Name | UCHL5 UCH37 |
| Organism | Bos taurus (Bovine) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos (oxen cattle) Bos taurus (Bovine) |
| Enzyme Sequence | MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDAKTAAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEPMDTDQGSNMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAKKAQETK |
| Enzyme Length | 328 |
| Uniprot Accession Number | Q9XSJ0 |
| Absorption | |
| Active Site | ACT_SITE 88; /note=Nucleophile; /evidence=ECO:0000250; ACT_SITE 164; /note=Proton donor; /evidence=ECO:0000250 |
| Activity Regulation | ACTIVITY REGULATION: Activated by ADRM1. Inhibited by interaction with NFRKB (By similarity). {ECO:0000250}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; |
| DNA Binding | |
| EC Number | 3.4.19.12 |
| Enzyme Function | FUNCTION: Protease that specifically cleaves 'Lys-48'-linked polyubiquitin chains. Deubiquitinating enzyme associated with the 19S regulatory subunit of the 26S proteasome. Putative regulatory component of the INO80 complex; however is inactive in the INO80 complex and is activated by a transient interaction of the INO80 complex with the proteasome via ADRM1 (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Modified residue (3); Region (1); Sequence conflict (1); Site (1) |
| Keywords | Acetylation;Cytoplasm;DNA damage;DNA recombination;DNA repair;Hydrolase;Nucleus;Protease;Proteasome;Reference proteome;Thiol protease;Transcription;Transcription regulation;Ubl conjugation pathway |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. Nucleus {ECO:0000250}. Note=Associates with the proteasome 19S subunit in the cytoplasm. Associates with the INO80 complex in the nucleus (By similarity). {ECO:0000250}. |
| Modified Residue | MOD_RES 47; /note=N6-succinyllysine; /evidence=ECO:0000250|UniProtKB:Q9WUP7; MOD_RES 158; /note=N6-acetyllysine; /evidence=ECO:0000250|UniProtKB:Q9Y5K5; MOD_RES 288; /note=N6-succinyllysine; /evidence=ECO:0000250|UniProtKB:Q9WUP7 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 37,432 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.4.19.12; |