| IED ID | IndEnz0002011980 |
| Enzyme Type ID | protease011980 |
| Protein Name |
Developmental and secondary metabolism regulator veA Velvet complex subunit A |
| Gene Name | veA AFUA_1G12490 |
| Organism | Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Eurotiales (green and blue molds) Aspergillaceae Aspergillus Aspergillus subgen. Fumigati Neosartorya fumigata (Aspergillus fumigatus) Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus) |
| Enzyme Sequence | MATRPPLMPPANETESSVSRISREGKKITYKLSVMQQPERARACGAGAKSSADRRPVDPPPVVELRIFESDPNDDLHKTDITFAYNANFFLFATLETARPMAQGRLTGPPTCPVLTGVPVAGVAYLDRPQQAGYFIFPDLSVRHEGRYRLSFHLYEEIKDIKDADKDTPMPDLNSSTNLTKPSAPKAHLNFRLEVKSVPFTVYSAKKFPGLATSTSLSRIIAEQGCRVRIRRDVRMRRRGEKRTDDYDFDDERAFATRSDRYTTPDMYAANSAERARSTSISTTADTSFPYGSDAQRRPSAGDYGFQGAQPYQRSMPAASAAPAPAPVHSPATSAQTSSYQSHLSFGATQSQYPAPQLPPTPQSATPTNTYSPHPSYSHSRNPSNGTEYDATSSGYPYPQPRLPADRPSYSKAALPPLRLEPPKAPNMQTSTDSRSSDANAYPTLSQPPVPRAPTPANHVTSLPPLKVLSGEYSHPSQPNAQSPHHDLGSGKRLLWETNHTLSKRSHEETFGSDERPLHNGMRPDMDQYPSMGRKQPDYGRLPFYTDSRDEMAYKRANGRMVMKILPALP |
| Enzyme Length | 570 |
| Uniprot Accession Number | E9RCK4 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Component of the velvet transcription factor complex that controls sexual/asexual developmental ratio in response to light, promoting sexual development in the darkness while stimulating asexual sporulation under illumination (By similarity). The velvet complex hat acts as a global regulator for secondary metabolite gene expression (By similarity). Controls the expression of hundreds of genes, including those comprising more than a dozen known secondary metabolite gene clusters (PubMed:24116213). Controls the expression of the gliotoxin gene cluster (PubMed:23087369). Controls the expression of the fumagillin, fumitremorgin G, fumigaclavine C and glionitrin gene clusters (PubMed:24116213). The regulation of the fumagillin gene cluster and fumagillin production is performed through direct control of the expression of fumR (PubMed:24116213). Negatively regulates conidiation (PubMed:22970834, PubMed:23087369). Required for normal protease activity (PubMed:23087369). {ECO:0000250|UniProtKB:C8VTV4, ECO:0000269|PubMed:22970834, ECO:0000269|PubMed:23087369, ECO:0000269|PubMed:24116213}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Compositional bias (5); Domain (1); Motif (1); Region (5) |
| Keywords | Cytoplasm;Nucleus;Reference proteome;Sporulation;Transcription;Transcription regulation |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Nucleus {ECO:0000250|UniProtKB:C8VTV4}. Cytoplasm {ECO:0000250|UniProtKB:C8VTV4}. Note=Enriched in the nucleus in the dark (By similarity). {ECO:0000250|UniProtKB:C8VTV4}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 39..44; /note=Nuclear localization signal; /evidence=ECO:0000250|UniProtKB:C8VTV4 |
| Gene Encoded By | |
| Mass | 63,032 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |