IED ID | IndEnz0002011983 |
Enzyme Type ID | protease011983 |
Protein Name |
Thrombin-like enzyme batroxobin BX SVTLE EC 3.4.21.74 Bothrops atrox serine proteinase Defibrase Fibrinogen-clotting enzyme Reptilase Snake venom serine protease SVSP Venombin A |
Gene Name | |
Organism | Bothrops atrox (Barba amarilla) (Fer-de-lance) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Viperidae Crotalinae (pit vipers) Bothrops Bothrops atrox (Barba amarilla) (Fer-de-lance) |
Enzyme Sequence | MVLIRVIANLLILQVSYAQKSSELVIGGDECDINEHPFLAFMYYSPRYFCGMTLINQEWVLTAAHCNRRFMRIHLGKHAGSVANYDEVVRYPKEKFICPNKKKNVITDKDIMLIRLDRPVKNSEHIAPLSLPSNPPSVGSVCRIMGWGAITTSEDTYPDVPHCANINLFNNTVCREAYNGLPAKTLCAGVLQGGIDTCGGDSGGPLICNGQFQGILSWGSDPCAEPRKPAFYTKVFDYLPWIQSIIAGNKTATCP |
Enzyme Length | 255 |
Uniprot Accession Number | P04971 |
Absorption | |
Active Site | ACT_SITE 65; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 110; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 202; /note=Charge relay system; /evidence=ECO:0000250 |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | CATALYTIC ACTIVITY: Reaction=Selective cleavage of Arg-|-Xaa bond in fibrinogen, to form fibrin, and release fibrinopeptide A. The specificity of further degradation of fibrinogen varies with species origin of the enzyme.; EC=3.4.21.74; |
DNA Binding | |
EC Number | 3.4.21.74 |
Enzyme Function | FUNCTION: Thrombin-like snake venom serine protease. Cleaves Arg-Gly bonds in fibrinogen alpha chains (FGA). {ECO:0000269|PubMed:1011993}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Active site (3); Chain (1); Disulfide bond (6); Domain (1); Erroneous gene model prediction (1); Glycosylation (2); Propeptide (1); Signal peptide (1); Site (1) |
Keywords | Blood coagulation cascade activating toxin;Disulfide bond;Glycoprotein;Hemostasis impairing toxin;Hydrolase;Pharmaceutical;Protease;Secreted;Serine protease;Signal;Toxin;Zymogen |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | SIGNAL 1..18; /evidence=ECO:0000250 |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 28,189 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |