| IED ID | IndEnz0002011999 |
| Enzyme Type ID | protease011999 |
| Protein Name |
Uncharacterized protein YpuA ORFX19 |
| Gene Name | ypuA BSU23370 |
| Organism | Bacillus subtilis (strain 168) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus subtilis Bacillus subtilis subsp. subtilis Bacillus subtilis (strain 168) |
| Enzyme Sequence | MKKIWIGMLAAAVLLLMVPKVSLADAAVGDVIVTLGADLSESDKQKVLDEMNVPDNATTVTVTNKEEHEYLGKYISNAQIGSRAISSSSITIAKKGSGLNVETHNISGITDEMYLNALMTAGVKDAKVYVTAPFEVSGTAALTGLIKAYEVSSDEAISEDVKQVANQELVTTSELGDKIGNENAAALIAKIKEEFAKNGVPDNKADIEKQVDDAASDLNVTLTDSQKNQLVSLFNKMKNADIDWGQVSDQLDKAKDKITKFIESDEGKNFIQKVIDFFVSIWNAIVSIFK |
| Enzyme Length | 290 |
| Uniprot Accession Number | P31847 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1) |
| Keywords | Cell membrane;Membrane;Reference proteome |
| Interact With | |
| Induction | INDUCTION: Transcribed under partial control of SigM ECF sigma factor (PubMed:17434969). {ECO:0000269|PubMed:17434969}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:22882210}. Membrane raft {ECO:0000269|PubMed:22882210}. Note=Present in detergent-resistant membrane (DRM) fractions that may be equivalent to eukaryotic membrane rafts; these rafts include proteins involved in signaling, molecule trafficking and protein secretion. {ECO:0000269|PubMed:22882210}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 31,295 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |