| IED ID | IndEnz0002012018 |
| Enzyme Type ID | protease012018 |
| Protein Name |
Trypsin Tyr p 3.0101 EC 3.4.21.4 Mite group 3 allergen Tyr p 3 allergen Tyr p 3.0101 |
| Gene Name | |
| Organism | Tyrophagus putrescentiae (Mold mite) (Acarus putrescentiae) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Chelicerata Arachnida Acari Acariformes Sarcoptiformes Astigmata Acaroidea Acaridae Tyrophaginae Tyrophagus (bulb mites) Tyrophagus putrescentiae (Mold mite) (Acarus putrescentiae) |
| Enzyme Sequence | MKILLFLCFLVSVAFAKPPTIQLKSNTKSQNGFIVGGTEAVDGDAPHQVSLQHTSHFCGGSIISERWILTAAHCIDADDLSNPGGMSVRYNTLNLKSGTLVKVKSIKVHEQYSNVTSDNDIALLETVASMNLNQTNAVAAKLPAKGNDPQDGDLFLSGWGTLHSGDTTIPTNLQKVTVPLTNRSVCAEAYTGIVNITENMFCAGKMGIGGVDSCQGDSGGGAMLNKELVGVVSFGVGCGDPKYPGVYTRVSQYLDWIELSAKSSATTLVAVNITLFLTLFIGAIW |
| Enzyme Length | 285 |
| Uniprot Accession Number | C6ZDB5 |
| Absorption | |
| Active Site | ACT_SITE 73; /note=Charge relay system; /evidence=ECO:0000255|PROSITE-ProRule:PRU00274; ACT_SITE 120; /note=Charge relay system; /evidence=ECO:0000255|PROSITE-ProRule:PRU00274; ACT_SITE 218; /note=Charge relay system; /evidence=ECO:0000255|PROSITE-ProRule:PRU00274 |
| Activity Regulation | ACTIVITY REGULATION: Inhibited by the serine protease inhibitor phenylmethylsulfonyl, and trypsin inhibitors soybean trypsin inhibitor and tosyllysine chloromethyl ketone. Not inhibited by dithiothreitol, a cysteine protease inhibitor. {ECO:0000269|PubMed:19339798}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Preferential cleavage: Arg-|-Xaa, Lys-|-Xaa.; EC=3.4.21.4; Evidence={ECO:0000269|PubMed:19339798}; |
| DNA Binding | |
| EC Number | 3.4.21.4 |
| Enzyme Function | FUNCTION: Digests TAMe (p-toluene arginine methyl ester), but not ethyl N-benzoyl-L-tyrosinate (BTEE). {ECO:0000269|PubMed:19339798}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Disulfide bond (3); Domain (1); Propeptide (1); Signal peptide (1); Site (1) |
| Keywords | Allergen;Direct protein sequencing;Disulfide bond;Hydrolase;Protease;Secreted;Serine protease;Signal;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:19339798}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..16; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 30,177 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |