| IED ID | IndEnz0002012028 |
| Enzyme Type ID | protease012028 |
| Protein Name |
Ubiquitin carboxyl-terminal hydrolase isozyme L4 UCH-L4 EC 3.4.19.12 Ubiquitin thioesterase L4 |
| Gene Name | Uchl4 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMESELLSIIPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGTIGLIHAIANNKDKVHFESGSTLKKFLEESVSMSPEERAKYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGWKPFPINHGKTSDETLLEDVIKVCKKFMERDPDELRFNAIALSAA |
| Enzyme Length | 233 |
| Uniprot Accession Number | P58321 |
| Absorption | |
| Active Site | ACT_SITE 95; /note=Nucleophile; /evidence=ECO:0000250; ACT_SITE 172; /note=Proton donor; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; |
| DNA Binding | |
| EC Number | 3.4.19.12 |
| Enzyme Function | FUNCTION: Ubiquitin-protein hydrolase is involved both in the processing of ubiquitin precursors and of ubiquitinated proteins. This enzyme is a thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of ubiquitin. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Modified residue (1); Region (2); Site (1) |
| Keywords | Cytoplasm;Hydrolase;Phosphoprotein;Protease;Reference proteome;Thiol protease;Ubl conjugation pathway |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. |
| Modified Residue | MOD_RES 133; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P15374 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 21267068; 29590634; |
| Motif | |
| Gene Encoded By | |
| Mass | 26,450 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |