| IED ID | IndEnz0002012032 |
| Enzyme Type ID | protease012032 |
| Protein Name |
WAP four-disulfide core domain protein 2 Epididymal protein BE-20 Major epididymis-specific protein E4 |
| Gene Name | WFDC2 |
| Organism | Oryctolagus cuniculus (Rabbit) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Lagomorpha Leporidae (rabbits and hares) Oryctolagus Oryctolagus cuniculus (Rabbit) |
| Enzyme Sequence | MPASRLVPLGAVLLLGLLLLLELPPVTGTGADKPGVCPQLSADLNCTQDCRADQDCAENLKCCRAGCSAICSIPNEKEGSCPSIDFPQLGICQDLCQVDSQCPGKMKCCLNGCGKVSCVTPNF |
| Enzyme Length | 123 |
| Uniprot Accession Number | Q28631 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Broad range protease inhibitor. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (8); Domain (2); Glycosylation (1); Signal peptide (1) |
| Keywords | Aspartic protease inhibitor;Direct protein sequencing;Disulfide bond;Glycoprotein;Protease inhibitor;Reference proteome;Repeat;Secreted;Serine protease inhibitor;Signal;Thiol protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..28; /evidence=ECO:0000269|PubMed:8886263 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 12,803 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |