| IED ID |
IndEnz0002012046 |
| Enzyme Type ID |
protease012046 |
| Protein Name |
Antitoxin YafN
|
| Gene Name |
yafN b0232 JW0222 |
| Organism |
Escherichia coli (strain K12) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Proteobacteria
Gammaproteobacteria
Enterobacterales
Enterobacteriaceae
Escherichia
Escherichia coli
Escherichia coli (strain K12)
|
| Enzyme Sequence |
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRAEQYLNDMTDDDFNDFKE |
| Enzyme Length |
97 |
| Uniprot Accession Number |
Q47156 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Antitoxin component of a type II toxin-antitoxin (TA) system. Functions as an mRNA interferase antitoxin; overexpression prevents YafO-mediated cessation of cell growth and inhibition of cell proliferation. {ECO:0000269|PubMed:19617347, ECO:0000269|PubMed:19943910}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1) |
| Keywords |
DNA damage;DNA repair;DNA-binding;Reference proteome;Repressor;SOS response;Toxin-antitoxin system;Transcription;Transcription regulation |
| Interact With |
Q47157 |
| Induction |
INDUCTION: Induced by amino acid starvation, glucose starvation, the DNA cross-linker mitomycin C (SOS response) and when translation is blocked. Induction is decreased in the absence of the Lon protease suggesting, by homology to other toxin-antitoxin systems, that Lon may degrade the YafN antitoxin. Transcription is negatively regulated by the cognate locus, probably by this protein. A member of the dinB-yafNOP operon; it has 2 promoters, 1 upstream of dinB and 1 specific for yafN-yfaO. {ECO:0000269|PubMed:12813093, ECO:0000269|PubMed:19943910}. |
| Subcellular Location |
|
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
16606699;
|
| Motif |
|
| Gene Encoded By |
|
| Mass |
11,234 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|