| IED ID | IndEnz0002012053 |
| Enzyme Type ID | protease012053 |
| Protein Name |
Tumor necrosis factor receptor superfamily member 22 Decoy TRAIL receptor 2 TNF receptor family member SOBa TNF receptor homolog 2 Tumor necrosis factor receptor p60 homolog 2 |
| Gene Name | Tnfrsf22 Dctrailr2 Tnfrh2 Tnfrsf1al2 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MFGFFCSLVSSLSRWFLWRRLLLLLLLLLLNLPLQVKFAMLELHSFKCPAGEYWSKDVCCKNCSAGTFVKAPCEIPHTQGQCEKCHPGTFTEKDNYLDACILCSTCDKDQEMVADCSATSDRKCQCRTGLYYYDPKFPESCRPCTKCPQGIPVLQECNSTANTVCSSSVSNPRNRLFLLLSPLSVLIVSVVVFRIIRR |
| Enzyme Length | 198 |
| Uniprot Accession Number | Q9ER62 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Receptor for the cytotoxic ligand TNFSF10/TRAIL. Lacks a cytoplasmic death domain and hence is not capable of inducing apoptosis. Protects cells against TRAIL mediated apoptosis possibly through ligand competition. Cannot induce the NF-kappa-B pathway. {ECO:0000269|PubMed:12466268}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (1); Chain (1); Disulfide bond (9); Erroneous gene model prediction (1); Erroneous initiation (1); Frameshift (1); Glycosylation (2); Repeat (3); Sequence conflict (3); Topological domain (2); Transmembrane (1) |
| Keywords | Alternative splicing;Cell membrane;Disulfide bond;Glycoprotein;Membrane;Receptor;Reference proteome;Repeat;Secreted;Signal-anchor;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: [Isoform 1]: Cell membrane {ECO:0000305}; Single-pass type II membrane protein {ECO:0000305}.; SUBCELLULAR LOCATION: [Isoform 2]: Secreted {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11217851; 12102730; 12466851; 12473685; 14610273; 22595876; 29973541; |
| Motif | |
| Gene Encoded By | |
| Mass | 22,375 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |