| IED ID | IndEnz0002012062 |
| Enzyme Type ID | protease012062 |
| Protein Name |
SUMO-1 cysteine protease S273R pS273R EC 3.4.22.- |
| Gene Name | War-121 |
| Organism | African swine fever virus (isolate Warthog/Namibia/Wart80/1980) (ASFV) |
| Taxonomic Lineage | Viruses Varidnaviria Bamfordvirae Nucleocytoviricota Pokkesviricetes Asfuvirales Asfarviridae Asfivirus African swine fever virus (ASFV) African swine fever virus (isolate Warthog/Namibia/Wart80/1980) (ASFV) |
| Enzyme Sequence | MSILEKITSSPSECAEHLTNKDSCLSKKIQKELTSFLQKKETLGCDSESCVITHPAVKAYAQQKGLDLSKELETRFKAPGPRNNTGLLTNFNIDETLQRWAIKYTKFFNCPFSMMDFERVHYKFNQVDMVKVYKGEELQYVEGKVVKRPCNTFGCVLNTDFSTGTGKHWVAIFVDMRGDCWSIEYFNSAGNSPPGPVIRWMERVKQQLLKIHHTVKTLAVTNIRHQRSQTECGPYSLFYIRARLDNVSYAHFISARITDEDMYKFRTHLFRIA |
| Enzyme Length | 273 |
| Uniprot Accession Number | P0C9B8 |
| Absorption | |
| Active Site | ACT_SITE 168; /evidence=ECO:0000250|UniProtKB:Q00946; ACT_SITE 187; /evidence=ECO:0000250|UniProtKB:P0C9B9; ACT_SITE 232; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:Q00946 |
| Activity Regulation | |
| Binding Site | BINDING 226; /note=Substrate; /evidence=ECO:0000255 |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.22.- |
| Enzyme Function | FUNCTION: SUMO-1 cysteine protease catalyzes the maturation of the pp220 and pp62 polyprotein precursors into core-shell proteins. {ECO:0000250|UniProtKB:Q00946}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Binding site (1); Chain (1) |
| Keywords | Host cytoplasm;Hydrolase;Late protein;Protease;Reference proteome;Thiol protease;Virion |
| Interact With | |
| Induction | INDUCTION: Expressed in the late phase of the viral replicative cycle. {ECO:0000250|UniProtKB:Q00946}. |
| Subcellular Location | SUBCELLULAR LOCATION: Host cytoplasm {ECO:0000250|UniProtKB:Q00946}. Virion {ECO:0000250|UniProtKB:Q00946}. Note=Found in cytoplasmic viral factories during assembly. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 31,549 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |