IED ID | IndEnz0002012062 |
Enzyme Type ID | protease012062 |
Protein Name |
SUMO-1 cysteine protease S273R pS273R EC 3.4.22.- |
Gene Name | War-121 |
Organism | African swine fever virus (isolate Warthog/Namibia/Wart80/1980) (ASFV) |
Taxonomic Lineage | Viruses Varidnaviria Bamfordvirae Nucleocytoviricota Pokkesviricetes Asfuvirales Asfarviridae Asfivirus African swine fever virus (ASFV) African swine fever virus (isolate Warthog/Namibia/Wart80/1980) (ASFV) |
Enzyme Sequence | MSILEKITSSPSECAEHLTNKDSCLSKKIQKELTSFLQKKETLGCDSESCVITHPAVKAYAQQKGLDLSKELETRFKAPGPRNNTGLLTNFNIDETLQRWAIKYTKFFNCPFSMMDFERVHYKFNQVDMVKVYKGEELQYVEGKVVKRPCNTFGCVLNTDFSTGTGKHWVAIFVDMRGDCWSIEYFNSAGNSPPGPVIRWMERVKQQLLKIHHTVKTLAVTNIRHQRSQTECGPYSLFYIRARLDNVSYAHFISARITDEDMYKFRTHLFRIA |
Enzyme Length | 273 |
Uniprot Accession Number | P0C9B8 |
Absorption | |
Active Site | ACT_SITE 168; /evidence=ECO:0000250|UniProtKB:Q00946; ACT_SITE 187; /evidence=ECO:0000250|UniProtKB:P0C9B9; ACT_SITE 232; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:Q00946 |
Activity Regulation | |
Binding Site | BINDING 226; /note=Substrate; /evidence=ECO:0000255 |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | 3.4.22.- |
Enzyme Function | FUNCTION: SUMO-1 cysteine protease catalyzes the maturation of the pp220 and pp62 polyprotein precursors into core-shell proteins. {ECO:0000250|UniProtKB:Q00946}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Active site (3); Binding site (1); Chain (1) |
Keywords | Host cytoplasm;Hydrolase;Late protein;Protease;Reference proteome;Thiol protease;Virion |
Interact With | |
Induction | INDUCTION: Expressed in the late phase of the viral replicative cycle. {ECO:0000250|UniProtKB:Q00946}. |
Subcellular Location | SUBCELLULAR LOCATION: Host cytoplasm {ECO:0000250|UniProtKB:Q00946}. Virion {ECO:0000250|UniProtKB:Q00946}. Note=Found in cytoplasmic viral factories during assembly. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 31,549 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |