Detail Information for IndEnz0002012062
IED ID IndEnz0002012062
Enzyme Type ID protease012062
Protein Name SUMO-1 cysteine protease S273R
pS273R
EC 3.4.22.-
Gene Name War-121
Organism African swine fever virus (isolate Warthog/Namibia/Wart80/1980) (ASFV)
Taxonomic Lineage Viruses Varidnaviria Bamfordvirae Nucleocytoviricota Pokkesviricetes Asfuvirales Asfarviridae Asfivirus African swine fever virus (ASFV) African swine fever virus (isolate Warthog/Namibia/Wart80/1980) (ASFV)
Enzyme Sequence MSILEKITSSPSECAEHLTNKDSCLSKKIQKELTSFLQKKETLGCDSESCVITHPAVKAYAQQKGLDLSKELETRFKAPGPRNNTGLLTNFNIDETLQRWAIKYTKFFNCPFSMMDFERVHYKFNQVDMVKVYKGEELQYVEGKVVKRPCNTFGCVLNTDFSTGTGKHWVAIFVDMRGDCWSIEYFNSAGNSPPGPVIRWMERVKQQLLKIHHTVKTLAVTNIRHQRSQTECGPYSLFYIRARLDNVSYAHFISARITDEDMYKFRTHLFRIA
Enzyme Length 273
Uniprot Accession Number P0C9B8
Absorption
Active Site ACT_SITE 168; /evidence=ECO:0000250|UniProtKB:Q00946; ACT_SITE 187; /evidence=ECO:0000250|UniProtKB:P0C9B9; ACT_SITE 232; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:Q00946
Activity Regulation
Binding Site BINDING 226; /note=Substrate; /evidence=ECO:0000255
Calcium Binding
catalytic Activity
DNA Binding
EC Number 3.4.22.-
Enzyme Function FUNCTION: SUMO-1 cysteine protease catalyzes the maturation of the pp220 and pp62 polyprotein precursors into core-shell proteins. {ECO:0000250|UniProtKB:Q00946}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Active site (3); Binding site (1); Chain (1)
Keywords Host cytoplasm;Hydrolase;Late protein;Protease;Reference proteome;Thiol protease;Virion
Interact With
Induction INDUCTION: Expressed in the late phase of the viral replicative cycle. {ECO:0000250|UniProtKB:Q00946}.
Subcellular Location SUBCELLULAR LOCATION: Host cytoplasm {ECO:0000250|UniProtKB:Q00946}. Virion {ECO:0000250|UniProtKB:Q00946}. Note=Found in cytoplasmic viral factories during assembly.
Modified Residue
Post Translational Modification
Signal Peptide
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif
Gene Encoded By
Mass 31,549
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda