| IED ID | IndEnz0002012068 |
| Enzyme Type ID | protease012068 |
| Protein Name |
Thrombin-like enzyme asperase SVTLE EC 3.4.21.- Fibrinogen-clotting enzyme Snake venom serine protease SVSP |
| Gene Name | |
| Organism | Bothrops asper (Terciopelo) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Viperidae Crotalinae (pit vipers) Bothrops Bothrops asper (Terciopelo) |
| Enzyme Sequence | MVLIRVLANLLILQLSYAQKSSELVIGGDECNINEHRSLVVLFNSSGFLCAGTLVQDEWVLTAANCDSKNFQMQLGVHSKKVLNEDEQTRDPKEEASLCPNRKKDDEVDKDIMLIKLDSRVSNSEHIAPLSLPSSPPSVGSVCRIMGWGTISPTKETYPDVPHCANINILDHAVCRAAYPWQPVSSTTLCAGILQGGKDTCWGDSGGPLICNGEFQGIVSWGAHPCGQPHNPGVYTKVSDYTEWIKSIIAGNTAAACPP |
| Enzyme Length | 259 |
| Uniprot Accession Number | Q072L6 |
| Absorption | |
| Active Site | ACT_SITE 111; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 205; /note=Charge relay system; /evidence=ECO:0000250 |
| Activity Regulation | ACTIVITY REGULATION: Inhibited by PMSF. {ECO:0000269|PubMed:17994164}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Snake venom serine protease that clots human plasma and bovine fibrinogen. Upon intravenous injection in mice, this protease renders blood unclottable (defibri(ogen)ation). Intravenous administration (10 and 5 ug) induces a gyroxin-like effect: loss of the righting reflex, opisthotonus, and intermittent rotations over the long axis of the body. These effects persisted during approximately 10 minutes, after which the animals apparently recovers. {ECO:0000269|PubMed:17994164}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Disulfide bond (6); Domain (1); Glycosylation (1); Propeptide (1); Region (1); Signal peptide (1) |
| Keywords | Blood coagulation cascade activating toxin;Direct protein sequencing;Disulfide bond;Glycoprotein;Hemostasis impairing toxin;Hydrolase;Protease;Secreted;Serine protease;Sialic acid;Signal;Toxin;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | PTM: The different mass observed by mass spectrometry may represent 3 different glycoforms that bear a single non- (27066), mono- (27357), and di-sialylated (27649), fucosylated complex-type dianntenary glycan chain. {ECO:0000269|PubMed:17994164}. |
| Signal Peptide | SIGNAL 1..18; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 28,019 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |