| IED ID |
IndEnz0002012090 |
| Enzyme Type ID |
protease012090 |
| Protein Name |
Cell wall-binding protein YwsB
|
| Gene Name |
ywsB BSU35970 |
| Organism |
Bacillus subtilis (strain 168) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Firmicutes
Bacilli
Bacillales
Bacillaceae
Bacillus
Bacillus subtilis group
Bacillus subtilis
Bacillus subtilis subsp. subtilis
Bacillus subtilis (strain 168)
|
| Enzyme Sequence |
MNKPTKLFSTLALAAGMTAAAAGGAGTIHAQQPETTVSIDDLYSYPIDSYLVSAEALNVRTKPSASSQKADTLHLGDSLKLISFSNADWAKVKYKNGKTGFVSTHYIVKAATTVKTKTKTKVYTSADGKSIKTLPADTSVSFLGWSKTNKGGFDFDWVFVDYGGTTGYMKTKDLHMTK |
| Enzyme Length |
178 |
| Uniprot Accession Number |
P96729 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
ACTIVITY REGULATION: Increases in stationary phase in a strain lacking the WprA protease. |
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
|
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Domain (2); Signal peptide (1) |
| Keywords |
Cell wall;Direct protein sequencing;Reference proteome;Secreted;Signal |
| Interact With |
|
| Induction |
|
| Subcellular Location |
SUBCELLULAR LOCATION: Secreted, cell wall {ECO:0000269|PubMed:11987133}. Note=Released into the extracellular medium in a strain lacking the WprA protease. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
SIGNAL 1..30; /evidence=ECO:0000269|PubMed:11987133 |
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
19,109 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|