| IED ID | IndEnz0002012158 |
| Enzyme Type ID | protease012158 |
| Protein Name |
Kunitz-type conkunitzin-S1 Conk-S1 |
| Gene Name | |
| Organism | Conus striatus (Striated cone) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae (cone shells) Conus Pionoconus Conus striatus (Striated cone) |
| Enzyme Sequence | MEGRRFAAVLILTICMLAPGTGTLLPKDRPSLCDLPADSGSGTKAEKRIYYNSARKQCLRFDYTGQGGNENNFRRTYDCQRTCLYT |
| Enzyme Length | 86 |
| Uniprot Accession Number | P0C1X2 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Blocks specifically voltage-activated potassium channels (Kv) of the Shaker family (IC(50)=1.33 nM). {ECO:0000269|PubMed:15833744}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (5); Chain (1); Disulfide bond (2); Domain (1); Helix (2); Modified residue (1); Signal peptide (1); Turn (1) |
| Keywords | 3D-structure;Amidation;Direct protein sequencing;Disulfide bond;Ion channel impairing toxin;Neurotoxin;Potassium channel impairing toxin;Protease inhibitor;Secreted;Serine protease inhibitor;Signal;Toxin;Voltage-gated potassium channel impairing toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | MOD_RES 86; /note=Threonine amide; /evidence=ECO:0000269|PubMed:15833744 |
| Post Translational Modification | PTM: Contains 2 disulfide bonds instead of 3, as for all Kunitz domain proteins. A double Cys-mutant carrying an additional Cys bridge does not show difference in activity with the natural peptide. However, there are some differences in the kinetics of binding of both peptides to the channel (PubMed:15833744). {ECO:0000269|PubMed:15833744}. |
| Signal Peptide | SIGNAL 1..26; /evidence=ECO:0000269|PubMed:15833744 |
| Structure 3D | NMR spectroscopy (1); X-ray crystallography (4) |
| Cross Reference PDB | 1Y62; 2CA7; 6Q61; 6Q6C; 6YHY; |
| Mapped Pubmed ID | 31444298; 33771569; |
| Motif | |
| Gene Encoded By | |
| Mass | 9,661 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |