IED ID | IndEnz0002012183 |
Enzyme Type ID | protease012183 |
Protein Name |
Metalloproteinase inhibitor 1 Tissue inhibitor of metalloproteinases 1 TIMP-1 |
Gene Name | TIMP1 |
Organism | Papio cynocephalus (Yellow baboon) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Cercopithecoidea Cercopithecidae (Old World monkeys) Cercopithecinae Papio (baboons) Papio cynocephalus (Yellow baboon) |
Enzyme Sequence | MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRTRIA |
Enzyme Length | 207 |
Uniprot Accession Number | P49061 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14. Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling. {ECO:0000269|PubMed:7590279}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1); Disulfide bond (6); Domain (1); Glycosylation (2); Metal binding (1); Modified residue (1); Region (2); Signal peptide (1); Site (1) |
Keywords | Disulfide bond;Glycoprotein;Growth factor;Metal-binding;Metalloenzyme inhibitor;Metalloprotease inhibitor;Phosphoprotein;Protease inhibitor;Secreted;Signal;Zinc |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:7590279}. |
Modified Residue | MOD_RES 178; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P01033 |
Post Translational Modification | PTM: The activity of TIMP1 is dependent on the presence of disulfide bonds.; PTM: N-glycosylated. {ECO:0000250}. |
Signal Peptide | SIGNAL 1..23; /evidence=ECO:0000250 |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 23,213 |
Kinetics | |
Metal Binding | METAL 24; /note=Zinc; via amino nitrogen and carbonyl oxygen; shared with metalloproteinase partner; /evidence=ECO:0000250|UniProtKB:P16035 |
Rhea ID | |
Cross Reference Brenda |