| IED ID | IndEnz0002012188 |
| Enzyme Type ID | protease012188 |
| Protein Name |
TauPI-stichotoxin-Hcr2b TauPI-SHTX-Hcr2b Analgesic polypeptide HC1 APHC1 |
| Gene Name | |
| Organism | Heteractis crispa (Leathery sea anemone) (Radianthus macrodactylus) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Cnidaria Anthozoa (anthozoans) Hexacorallia Actiniaria (sea anemones) Stichodactylidae Heteractis Heteractis crispa (Leathery sea anemone) (Radianthus macrodactylus) |
| Enzyme Sequence | MKGTFLICLILIAGFSFKSTQAGSICLEPKVVGPCTAYFRRFYFDSETGKCTVFIYGGCEGNGNNFETLRACRAICRA |
| Enzyme Length | 78 |
| Uniprot Accession Number | B2G331 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: This protease inhibitor shows two different activities, it inhibits both the capsaicin receptor TRPV1 and serine proteases. It partially (max 50%) and reversibly inhibits capsaicin-induced response of TRPV1 (IC(50)=54 nM), a receptor of the pain pathway (PubMed:18579526, PubMed:24351908). The second activity is a weak inhibition of trypsin and chymotrypsin activity (Ki=1 uM and Ki=5 uM, respectively) (PubMed:18579526). In vivo, it shows antinociceptive and analgesic activities (PubMed:24351908). It significantly prolongs tail-flick latency and reduces capsaicin-induced acute pain (PubMed:18579526, PubMed:24351908). In vivo, unlike other TRPV1 antagonists whose activity is associated with hyperthermia, this protein has the remarkable feature of dropping core body temperature (PubMed:24351908). {ECO:0000269|PubMed:18579526, ECO:0000269|PubMed:22982418, ECO:0000269|PubMed:24351908}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Domain (1); Signal peptide (1); Site (7) |
| Keywords | Direct protein sequencing;Disulfide bond;Ion channel impairing toxin;Nematocyst;Neurotoxin;Protease inhibitor;Secreted;Serine protease inhibitor;Signal;Toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:18579526}. Nematocyst {ECO:0000269|PubMed:18579526}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..22; /evidence=ECO:0000269|PubMed:18579526 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 8,565 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |